rev:    January 24, 2005

HOME (index page)

Return  (alphabetical antibodies..index)


  ANTIBODIES  

(anti-Human and others as indicated)

RDI Divison of Fitzgerald Industries Intl  offers a wide line of  antibodies. Since no one antibody works best for all applications (neutralization, blotting, ELISA, etc), we offer many different types of antibodies to help solve this problem. Please inquire for other applications or types of antibodies not listed below.


Toll Receptor 2 and Toll Receptor 5
Goat anti-Human Toll Receptor 2 Extracellular Domain

Cat #: RDI-TOLL2RXabGX   $562.00

Presentation: 200ug of peptide affinity purified IgG in 0.1ml (2mg/ml) 10mM KHPO4, 140mM NaCl, pH7.2 with 1 mg/ml BSA and 0.1% sodium azide.

Host: Goat

Antigen: Synthetic peptide CLEIDASDLQSYEPKSLKSIQNVSHLI corresponding to a.a. 179-204 of human TLR2.

Specificity: Peptide sequence is < 50 % identical to other human TLR receptors in this region. The antiserum recognizes human TLR2. Not tested for cross-reactivity to mouse TLR2.

Applications:

    ELISA (peptide) 1:75000

     Western Blot N.D

      Immunohistochemistry 1:250

      Immunocytochemistry 1:500

     Flowcytometry N. D.

QC: Immunocytochemistry on human spleen sections or human peripheral blood.

Storage: Freeze at -80 °C. Stable for at least 3 years when stored at -80 °C. Avoid freeze/thaw cycles.

References: [1] Cloning and Characterization of Two Toll/Interluekin-1 Receptor-Like Genes TIL3 and TIL4: Evidence for a Multi-Gene Receptor Family in Humans. Blood, Vol 91, 4020-4027.

Note: Human Toll Like Receptor-2 (TLR2) is also described as Toll/Interluekin-1 Receptor-Like Gene 4 (TIL4).

For Research Use Only


Goat anti-Human Toll Receptor 5 Extracellular Domain

Cat #: RDI-TOLLR5XabGX   $562.00

Presentation: 200ug of peptide affinity purified IgG in 0.1ml (2mg/ml) 10mM KHPO4, 140mM NaCl, pH7.2 with 1 mg/ml BSA and 0.1% sodium azide.

Host: Goat

Antigen: Synthetic peptide DLSKNQIRSLYLHPSFGKLNSLKSIDFSSNQ corresponding to a.a. 151-181 of human TLR5.

Specificity: Peptide sequence is < 50 % identical to other human TLR receptors in this region. The antiserum recognizes human TLR5. Not tested for cross-reactivity to mouse TLR5.

Applications:

    ELISA (peptide) 1:75000

    Western Blot N.D

     Immunocytochemistry 1:500

     Immunohistochemistry 1:250

     Flowcytometry N.D.

QC: Immunocytochemistry on human spleen sections or human peripheral blood.

Storage: Freeze at -80 °C. Stable for at least 3 years when stored at -80 °C. Avoid freeze/thaw cycles.

References: [1]Cloning and Characterization of Two Toll/Interluekin-1 Receptor-Like Genes TIL3 and TIL4: Evidence for a Multi-Gene Receptor Family in Humans. Blood, Vol 91, 4020-4027.

Note: Human Toll Like Receptor-5 (TLR5) is also described as Toll/Interluekin-1 Receptor-Like Gene 3 (TIL3).

For Research Use Only


copyright by owner(s)

RDI Divison of Fitzgerald Industries Intl

34 Junction Square Drive

Concord MA 01742-3049

USA

phone (978) 371-6446 or (800) 370-2222

fax     (978) 371-2266

EMAIL:antibodies@fitzgerald-fii.com

Return  (alphabetical antibodies..index)

Ordering terms